PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G04038.1
Common NameAtbZIP48, bZIP48
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 166aa    MW: 19501.6 Da    PI: 6.7799
Description basic leucine-zipper 48
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G04038.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.89.9e-1374124555
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                  +++rr+ +NRe+ArrsR RK+  ++eL   v  L +eN  L+++l++ +++
  AT2G04038.1  74 RKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSET 124
                  79********************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.1E-1470134IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.58872123IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.5E-1074123No hitNo description
PfamPF001701.5E-1074124IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.14E-1274123No hitNo description
CDDcd147023.42E-1775123No hitNo description
PROSITE patternPS0003607792IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0009030anatomycarpel
PO:0025281anatomypollen
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MIPAEINGYF QYLSPEYNVI NMPSSPTSSL NYLNDLIINN NNYSSSSNSQ DLMISNNSTS  60
DEDHHQSIMV LDERKQRRML SNRESARRSR MRKQRHLDEL WSQVIRLRNE NNCLIDKLNR  120
VSETQNCVLK ENSKLKEEAS DLRQLVCELK SNKNNNNSFP REFEDN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18693RRSRMRKQ
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible263407_at0.0
Expression AtlasAT2G04038-
AtGenExpressAT2G04038-
ATTED-IIAT2G04038-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00262DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G04038.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G13600
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G04038
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0071780.0AC007178.6 Arabidopsis thaliana chromosome 2 clone F3L12 map mi320, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_178489.11e-116basic leucine-zipper 48
TrEMBLQ8RU591e-116Q8RU59_ARATH; BZIP protein (AtbZIP48)
STRINGAT2G04038.11e-116(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28922469
Representative plantOGRP31041129
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  4. Ehlert A, et al.
    Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors.
    Plant J., 2006. 46(5): p. 890-900
    [PMID:16709202]
  5. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  6. Kong H, et al.
    Patterns of gene duplication in the plant SKP1 gene family in angiosperms: evidence for multiple mechanisms of rapid gene birth.
    Plant J., 2007. 50(5): p. 873-85
    [PMID:17470057]